Article · Wikipedia archive · Last revised Jul 13, 2026

Chlorophycean mitochondrial code

The chlorophycean mitochondrial code is a genetic code found in the mitochondria of Chlorophyceae.

Last revised
Jul 13, 2026
Read time
≈ 1 min
Length
269 w
Citations
3
Source

The chlorophycean mitochondrial code (translation table 16) is a genetic code found in the mitochondria of Chlorophyceae.

Code

   AAs = FFLLSSSSYY*LCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = -----------------------------------M----------------------------
 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)

Differences from the standard code

DNA codons RNA codons This code (16) Standard code (1)
TAG UAG Leu (L) STOP = Ter (*)

Systematic range and comments

Chlorophyceae1 and the chytridiomycete fungus Spizellomyces punctatus.2

See also

See also

References

References

This article incorporates text from the United States National Library of Medicine, which is in the public domain. 3

  1. Y Hayashi-Ishimaru; T Ohama; Y Kawatsu; K Nakamura; S Osawa (June 1996). "UAG is a sense codon in several chlorophycean mitochondria". Current Genetics. 30 (1): 29–33. doi:10.1007/s002940050096. PMID 8662206. S2CID 7175211.
  2. M. J. Laforest; I. Roewer; B. F. Lang (1 February 1997). "Mitochondrial tRNAs in the lower fungus Spizellomyces punctatus: tRNA editing and UAG 'stop' codons recognized as leucine". Nucleic Acids Research. 25 (3): 626–32. doi:10.1093/nar/25.3.626. PMC 146481. PMID 9016605.
  3. Elzanowski A, Ostell J, Leipe D, Soussov V. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. Retrieved 10 August 2016.